I challenge anyone to find a longer and weirder (sp?) domain name:
http://141592653589793238462643383279502884197169399375105820974944592.com/
that’s impressive, but http://www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com/ beats it
**** how do they remember what it is?!
if you lived in that city don’t you think you could remember your claim to fame? probably not 
www.antidisestablishmentarianism.com
longest non-medical word in the english dictionary (even though it is almost a double negative, it is recognized)
that’s not true, the whales city I posted is longer…
but its a city not a word ;D
cities can be word’s, like dallas is a word, just not in the dictionary
this isn’t a domain name, but it’s a pretty long city name:
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
in New Zealand.
hmm… it’s a city but not one word, I don’t know…
no, it is one word, I don’t know why the forum is interpreting it that way. If i try to take away the spaces, letters start disappearing.
I guess the word is just too long 
lol, ok, in that case you’ve got me beat, again 
