I challenge anyone to find a longer and weirder (sp?) domain name:
http://141592653589793238462643383279502884197169399375105820974944592.com/
that’s impressive, but http://www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com/ beats it
**** how do they remember what it is?!
if you lived in that city don’t you think you could remember your claim to fame? probably not 
a while back there was a page with the domain www.[insert 60 "1"s here].com
yes 60 times the number 1!
The first one is pi out to the 63 digit, thats easy enough to remember…
What a waste of money lol 
that’s impressive, but http://www.llanfairpwllgwyngyllgoge…iogogogoch.com/ beats it
nope if you add the www in http://1415926535897932384626433832…0974944592.com/ which I omitted, you still end up with 3 more characters…
ugh! blast, I’ll try to do better, there are about ten cities in that network, did you see any others?
http://www.thepersonwithanewideaisacrank-untiltheideasucceeds-by-marktwain.com/
and
http://www.thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com/
Yay for Google.
[EDIT] Haha, and some guy has: http://www.iwantedthelongestdomainnameintheworldandthisisaprettygoodone.com/ with the email address: iwantedthelongestemailaddressintheworldandithinkifoundit@iwantedthelongestdomainnameintheworldandthisisaprettygoodone.com
wow, I think you beat us all
www . johnkerryisadouchebagbutimvotingforhimanyway . com
http://www.johnkerryisadouchebagbutimvotingforhimanyway.com/
(44 letters)
Majeye does not condone voting for Republicrats or Demopublicans…
www.antidisestablishmentarianism.com
longest non-medical word in the english dictionary (even though it is almost a double negative, it is recognized)
that’s not true, the whales city I posted is longer…
but its a city not a word ;D
cities can be word’s, like dallas is a word, just not in the dictionary
this isn’t a domain name, but it’s a pretty long city name:
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
in New Zealand.
hmm… it’s a city but not one word, I don’t know…
no, it is one word, I don’t know why the forum is interpreting it that way. If i try to take away the spaces, letters start disappearing.
I guess the word is just too long 
